PDB entry 1qn2

View 1qn2 on RCSB PDB site
Description: cytochrome ch from methylobacterium extorquens
Class: cytochrome
Keywords: cytochrome, cytochrome c, electron transport
Deposited on 1999-10-13, released 2000-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.161
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome ch
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QN2 (0-End)
    Domains in SCOPe 2.07: d1qn2a_
  • Chain 'B':
    Compound: cytochrome ch
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QN2
    Domains in SCOPe 2.07: d1qn2b_
  • Chain 'C':
    Compound: cytochrome ch
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QN2
    Domains in SCOPe 2.07: d1qn2c_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qn2A (A:)
    egdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqa
    dlkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qn2A (A:)
    egdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqa
    dlkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qn2B (B:)
    egdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqa
    dlkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qn2B (B:)
    gdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqad
    lkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qn2C (C:)
    egdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqa
    dlkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qn2C (C:)
    gdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqad
    lkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk