PDB entry 1qn0

View 1qn0 on RCSB PDB site
Description: solution structure of desulfovibrio gigas ferrocytochrome c3, nmr, 20 structures
Class: electron transport
Keywords: electron transport, hemeprotein, cytochrome c3, redox-bohr effect, redox cooperativity, energy transduction
Deposited on 1999-10-11, released 2000-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00133 (0-111)
      • conflict (39)
    Domains in SCOPe 2.08: d1qn0a_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qn0A (A:)
    vdvpadgakidfiaggeknltvvfnhsthkdvkcddchhqpgdkqyagcttdgchnildk
    adksvnswykvvhdakggakptcischkdkagddkelkkkltgckgsachps