PDB entry 1qmu

View 1qmu on RCSB PDB site
Description: duck carboxypeptidase d domain II
Class: carboxypeptidase
Keywords: carboxypeptidase, hydrolase, zinc-dependent protease
Deposited on 1999-10-06, released 2000-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase gp180 residues 503-882
    Species: LOPHONETTA SPECULARIOIDES [TaxId:8836]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qmua1, d1qmua2
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmuA (A:)
    qavqpvdfrhhhfsdmeiflrryaneypsitrlysvgksvelrelyvmeisdnpgiheag
    epefkyignmhgnevvgrelllnlieylcknfgtdpevtdlvqstrihimpsmnpdgyek
    sqegdrggtvgrnnsnnydlnrnfpdqffqvtdppqpetlavmswlktypfvlsanlhgg
    slvvnypfdddeqgiaiyskspddavfqqlalsyskenkkmyqgspckdlypteyfphgi
    tngaqwynvpggmqdwnylntncfevtielgcvkypkaeelpkyweqnrrsllqfikqvh
    rgiwgfvldatdgrgilnatisvadinhpvttykdgdywrllvqgtykvtasargydpvt
    ktvevdskggvqvnftlsrt