PDB entry 1qmt

View 1qmt on RCSB PDB site
Description: recombinant human eosinophil cationic protein
Deposited on 1999-10-06, released 2000-02-04
The last revision prior to the SCOP 1.63 freeze date was dated 2000-02-04, with a file datestamp of 2000-02-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.176
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1qmta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qmtA (A:)
mrppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqs
ircphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprds
prypvvpvhldtti