PDB entry 1qmr

View 1qmr on RCSB PDB site
Description: birch pollen allergen bet v 1 mutant n28t, k32q, e45s, p108g
Class: allergen
Keywords: allergen, pathogenesis-related protein
Deposited on 1999-10-06, released 2000-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: BETULA VERRUCOSA [TaxId:3505]
    Gene: BET V 1 1.2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered (27)
      • engineered (31)
      • engineered (44)
      • engineered (107)
      • conflict (61)
    Domains in SCOPe 2.06: d1qmra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmrA (A:)
    gvfnyetettsvipaarlfkafildgdtlfpqvapqaissvenisgnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatgdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn