PDB entry 1qmq

View 1qmq on RCSB PDB site
Description: optical detection of cytochrome p450 by sensitizer-linked substrates
Deposited on 1999-10-05, released 2000-10-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-31, with a file datestamp of 2000-10-31.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.216
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qmqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmqA (A:)
    anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
    qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
    nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
    gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
    gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
    gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreii
    vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav