PDB entry 1qmo

View 1qmo on RCSB PDB site
Description: structure of fril, a legume lectin that delays hematopoietic progenitor maturation
Class: lectin
Keywords: lectin, crosslink, hematopoietic progenitor, sugar complex
Deposited on 1999-10-04, released 1999-10-10
The last revision prior to the SCOP 1.73 freeze date was dated 2000-06-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.232
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose binding lectin, fril
    Species: Dolichos lab lab
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qmo.1
  • Chain 'B':
    Compound: mannose binding lectin, fril
    Species: Dolichos lab lab
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qmo.2
  • Chain 'C':
    Compound: mannose binding lectin, fril
    Species: Dolichos lab lab
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qmo.3
  • Chain 'D':
    Compound: mannose binding lectin, fril
    Species: Dolichos lab lab
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qmo.4
  • Chain 'E':
    Compound: mannose binding lectin, fril
    Species: Dolichos lab lab
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qmo.1
  • Chain 'F':
    Compound: mannose binding lectin, fril
    Species: Dolichos lab lab
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qmo.2
  • Chain 'G':
    Compound: mannose binding lectin, fril
    Species: Dolichos lab lab
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qmo.3
  • Chain 'H':
    Compound: mannose binding lectin, fril
    Species: Dolichos lab lab
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qmo.4
  • Heterogens: MAN, CA, MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmoA (A:)
    aqslsfsftkfdpnqedlifqghatstnnvlqvtkldsagnpvsssagrvlysaplrlwe
    dsavltsfdtiinfeistpytsriadglaffiappdsvisyhggflglfpnan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmoB (B:)
    aqslsfsftkfdpnqedlifqghatstnnvlqvtkldsagnpvsssagrvlysaplrlwe
    dsavltsfdtiinfeistpytsriadglaffiappdsvisyhggflglfpnan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmoC (C:)
    aqslsfsftkfdpnqedlifqghatstnnvlqvtkldsagnpvsssagrvlysaplrlwe
    dsavltsfdtiinfeistpytsriadglaffiappdsvisyhggflglfpnan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmoD (D:)
    aqslsfsftkfdpnqedlifqghatstnnvlqvtkldsagnpvsssagrvlysaplrlwe
    dsavltsfdtiinfeistpytsriadglaffiappdsvisyhggflglfpnan
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qmoE (E:)
    snvvavefdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrl
    svtsyyagskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtnvak
    kenenkyitrgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmoE (E:)
    snvvavefdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrl
    svtsyyagskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qmoF (F:)
    snvvavefdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrl
    svtsyyagskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtnvak
    kenenkyitrgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmoF (F:)
    snvvavefdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrl
    svtsyyagskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1qmoG (G:)
    snvvavefdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrl
    svtsyyagskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtnvak
    kenenkyitrgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmoG (G:)
    snvvavefdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrl
    svtsyyagskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qmoH (H:)
    snvvavefdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrl
    svtsyyagskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtnvak
    kenenkyitrgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmoH (H:)
    snvvavefdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrl
    svtsyyagskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtn