PDB entry 1qmn

View 1qmn on RCSB PDB site
Description:
Deposited on 1999-10-04, released 2000-01-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-30, with a file datestamp of 2000-04-30.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1qmna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qmnA (A:)
    lasanvdfafslykqlvlkapdknvifsppsistalaflslgahnttlteilkglkfnlt
    etseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafat
    dfqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdthq
    srfylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeeve
    amllpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitg
    arnlavsqvvhkavldvfeegteasaatavkitllsalvetrtivrfnrpflmiivptdt
    qniffmskvtnpkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmnA (A:)
    lasanvdfafslykqlvlkapdknvifsppsistalaflslgahnttlteilkglkfnlt
    etseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafat
    dfqdsaaakklindyvkngtrgkitdlisqtmmvlvnyiffkakwempfdpqdthqsrfy
    lskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeeveamll
    petlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitgarnl
    avsqvvhkavldvfeegteasaatalsalvetrtivrfnrpflmiivptdtqniffmskv
    tnpkq