PDB entry 1qmn

View 1qmn on RCSB PDB site
Description: Alpha1-antichymotrypsin serpin in the delta conformation (partial loop insertion)
Class: hydrolase inhibitor
Keywords: serpin, serine proteinase inhibitor, hydrolase inhibitor loop-sheet polymerization, emphysema, disease mutation, acute phase protein, conformational disease, hydrolase inhibitor
Deposited on 1999-10-04, released 2000-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antichymotrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01011
      • engineered mutation (55)
    Domains in SCOPe 2.07: d1qmna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qmnA (A:)
    masnspldeenltqenqdrgthvdlglasanvdfafslykqlvlkapdknvifsppsist
    alaflslgahnttlteilkglkfnltetseaeihqsfqhllrtlnqssdelqlsmgnamf
    vkeqlslldrftedakrlygseafatdfqdsaaakklindyvkngtrgkitdlikdldsq
    tmmvlvnyiffkakwempfdpqdthqsrfylskkkwvmvpmmslhhltipyfrdeelsct
    vvelkytgnasalfilpdqdkmeeveamllpetlkrwrdslefreigelylpkfsisrdy
    nlndillqlgieeaftskadlsgitgarnlavsqvvhkavldvfeegteasaatavkitl
    lsalvetrtivrfnrpflmiivptdtqniffmskvtnpkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmnA (A:)
    lasanvdfafslykqlvlkapdknvifsppsistalaflslgahnttlteilkglkfnlt
    etseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafat
    dfqdsaaakklindyvkngtrgkitdlisqtmmvlvnyiffkakwempfdpqdthqsrfy
    lskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeeveamll
    petlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitgarnl
    avsqvvhkavldvfeegteasaatalsalvetrtivrfnrpflmiivptdtqniffmskv
    tnpkq