PDB entry 1qmm

View 1qmm on RCSB PDB site
Description: structural insights into phoshoinositide 3-kinase enzymatic mechanism and signalling
Class: phosphoinositide 3-kinase gamma
Keywords: phosphoinositide 3-kinase gamma, secondary messenger generation, pi3k, pi 3k,
Deposited on 1999-10-02, released 1999-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-10-26, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.255
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase catalytic subunit
    Species: SUS SCROFA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02697 (2-End)
      • his tag (0-1)
      • conflict (363)
    Domains in SCOPe 2.07: d1qmma1, d1qmma2, d1qmma3, d1qmma4, d1qmma5
  • Heterogens: LU, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qmmA (A:)
    aaseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpw
    vtskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmakkkslmdi
    pesqnerdfvlrvcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrke
    ewplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprtadltv
    fveaniqygqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapal
    sgktsaempspeskgkaqllyyvnlllidhrfllrhgeyvlhmwqlsgkgedqgsfnadk
    ltsatnpdkensmsisilldnychpialpkhrptpdpegdrvraempnqlrkqleaiiat
    dplnpltaedkellwhfryeslkdpkaypklfssvkwgqqeivaktyqllakrevwdqsa
    ldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfl
    lkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvidm
    lqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrvpydpglkagalviekc
    kvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesld
    lcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlshwlkekcpieekf
    qaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidfghilgnyksflginke
    rvpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilfsmmlmtgmpq
    ltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhs
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmmA (A:)
    aaseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpw
    vtskplpeyllkkitnncvfivihrsqtikvsaddtpgtilqsfftkmakkknerdfvlr
    vcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrkecdrkfrvkirgi
    dipvlprtadltvfveaniqygqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgal
    lnlqiycqllyyvnlllidhrfllrhgeyvlhmwqlsgfnadkltsatnpdkensmsisi
    lldnhpialempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkaypklfssv
    kwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddv
    lhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavi
    leaylrgcgtamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenlqn
    lnlpqsfrvpydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkhgd
    dlrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstv
    gntgafkdevlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimise
    tgnlfhidfghvpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilf
    smmlmtgmpqltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlv
    l