PDB entry 1qml

View 1qml on RCSB PDB site
Description: hg complex of yeast 5-aminolaevulinic acid dehydratase
Deposited on 1999-10-02, released 2000-10-06
The last revision prior to the SCOP 1.65 freeze date was dated 2000-10-06, with a file datestamp of 2000-10-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.249
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1qmla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qmlA (A:)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
    eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
    grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
    ekgvvdlktiafeshqgflragarliitylapefldwldeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmlA (A:)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
    eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpfcyqlppagrglarralerdms
    egadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaaekgvvdlktiafes
    hqgflragarliitylapefldwldeen