PDB entry 1qmj

View 1qmj on RCSB PDB site
Description: CG-16, a homodimeric agglutinin from chicken liver
Class: sugar binding protein
Keywords: galectin, sugar binding protein
Deposited on 1999-09-29, released 2000-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactoside-binding lectin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qmja_
  • Chain 'B':
    Compound: beta-galactoside-binding lectin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qmjb_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmjA (A:)
    qglvvtqldvqpgecvkvkgkilsdakgfsvnvgkdsstlmlhfnprfdchgdvntvvcn
    skedgtwgeedrkadfpfqqgdkveicisfdaaevkvkvpevefefpnrlgmekiqylav
    egdfkvkaikfs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmjB (B:)
    qglvvtqldvqpgecvkvkgkilsdakgfsvnvgkdsstlmlhfnprfdchgdvntvvcn
    skedgtwgeedrkadfpfqqgdkveicisfdaaevkvkvpevefefpnrlgmekiqylav
    egdfkvkaikfs