PDB entry 1qmh

View 1qmh on RCSB PDB site
Description: Crystal structure of RNA 3'-terminal phosphate cyclase, an ubiquitous enzyme with unusual topology
Class: ligase
Keywords: 2'3'cyclic phosphate RNA, ligase
Deposited on 1999-09-28, released 2000-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA 3'-terminal phosphate cyclase
    Species: Escherichia coli [TaxId:83333]
    Gene: RTCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qmha1, d1qmha2
  • Chain 'B':
    Compound: RNA 3'-terminal phosphate cyclase
    Species: Escherichia coli [TaxId:83333]
    Gene: RTCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qmhb1, d1qmhb2
  • Heterogens: CIT, DTO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qmhA (A:)
    mvkrmialdgaqgegggqilrsalslsmitgqpftitsiragrakpgllrqhltavkaat
    eicgatvegaelgsqrllfrpgtvrggdyrfaigsagsctlvlqtvlpalwfadgpsrve
    vsggtdnpsappadfirrvlepllakigihqqttllrhgfypagggvvatevspvasfnt
    lqlgergnivqmrgevllagvprhvaereiatlagsfslheqnihnlprdqgpgntvsle
    veseniterffvvgekrvsaevvaaqlvkevkrylastaavgeyladqlvlpmalagage
    ftvahpschlltniavverflpvrfslietdgvtrvsiegshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmhA (A:)
    mialdgaqgegggqilrsalslsmitgqpftitsiragrakpgllrqhltavkaateicg
    atvegaelgsqrllfrpgtvrggdyrfaigsagsctlvlqtvlpalwfadgpsrvevsgg
    tdnpsappadfirrvlepllakigihqqttllrhgfypagggvvatevspvasfntlqlg
    ergnivqmrgevllagvprhvaereiatlagsfslheqnihnlprdqgpgntvslevese
    niterffvvgekrvsaevvaaqlvkevkrylastaavgeyladqlvlpmalagageftva
    hpschlltniavverflpvrfslietdgvtrvsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qmhB (B:)
    mvkrmialdgaqgegggqilrsalslsmitgqpftitsiragrakpgllrqhltavkaat
    eicgatvegaelgsqrllfrpgtvrggdyrfaigsagsctlvlqtvlpalwfadgpsrve
    vsggtdnpsappadfirrvlepllakigihqqttllrhgfypagggvvatevspvasfnt
    lqlgergnivqmrgevllagvprhvaereiatlagsfslheqnihnlprdqgpgntvsle
    veseniterffvvgekrvsaevvaaqlvkevkrylastaavgeyladqlvlpmalagage
    ftvahpschlltniavverflpvrfslietdgvtrvsiegshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmhB (B:)
    mialdgaqgegggqilrsalslsmitgqpftitsiragrakpgllrqhltavkaateicg
    atvegaelgsqrllfrpgtvrggdyrfaigsagsctlvlqtvlpalwfadgpsrvevsgg
    tdnpsappadfirrvlepllakigihqqttllrhgfypagggvvatevspvasfntlqlg
    ergnivqmrgevllagvprhvaereiatlagsfslheqnihnlprdqgpgntvslevese
    niterffvvgekrvsaevvaaqlvkevkrylastaavgeyladqlvlpmalagageftva
    hpschlltniavverflpvrfslietdgvtrvsie