PDB entry 1qmg

View 1qmg on RCSB PDB site
Description: acetohydroxyacid isomeroreductase complexed with its reaction product dihydroxy-methylvalerate, manganese and ADP-ribose.
Class: oxidoreductase
Keywords: oxidoreductase, branched chain amino acid biosynthesis, reaction product, manganese, ADP-ribose
Deposited on 1999-09-28, released 2000-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.196
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetohydroxy-acid isomeroreductase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qmga1, d1qmga2
  • Chain 'B':
    Compound: acetohydroxy-acid isomeroreductase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qmgb1, d1qmgb2
  • Chain 'C':
    Compound: acetohydroxy-acid isomeroreductase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qmgc1, d1qmgc2
  • Chain 'D':
    Compound: acetohydroxy-acid isomeroreductase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qmgd1, d1qmgd2
  • Heterogens: APX, MN, SO4, DMV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qmgA (A:)
    mvsapsidtpsattfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvi
    gwgsqapaqaqnlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetis
    gsdlvlllisdsaqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcp
    kgmgpsvrrlyvqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqe
    yksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmla
    lynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpaf
    pmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiin
    esvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapin
    qdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmgA (A:)
    sattfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqa
    qnlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllis
    dsaqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrl
    yvqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqeyksdifgerg
    illgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmlalynslseegk
    kdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpafpmgkidqtrm
    wkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiinesvieavdsl
    npfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapinqdlisnflsd
    pvheaigvcaqlrpsvdisvtadadfvrpelrqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qmgB (B:)
    mvsapsidtpsattfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvi
    gwgsqapaqaqnlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetis
    gsdlvlllisdsaqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcp
    kgmgpsvrrlyvqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqe
    yksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmla
    lynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpaf
    pmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiin
    esvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapin
    qdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmgB (B:)
    fdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaqnlk
    dslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisdsaq
    adnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrlyvqg
    kevngaginssfavhqdvdgratdvalgwsialgspftfattleqeyksdifgergillg
    avhgiveclfrrytesgmsedlaykntvecitgvisktistkgmlalynslseegkkdfq
    aaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpafpmgkidqtrmwkvg
    ekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiinesvieavdslnpfm
    hargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapinqdlisnflsdpvhe
    aigvcaqlrpsvdisvtadadfvrpelrqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qmgC (C:)
    mvsapsidtpsattfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvi
    gwgsqapaqaqnlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetis
    gsdlvlllisdsaqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcp
    kgmgpsvrrlyvqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqe
    yksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmla
    lynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpaf
    pmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiin
    esvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapin
    qdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmgC (C:)
    ttfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaqn
    lkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisds
    aqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrlyv
    qgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqeyksdifgergil
    lgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmlalynslseegkkd
    fqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpafpmgkidqtrmwk
    vgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiinesvieavdslnp
    fmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapinqdlisnflsdpv
    heaigvcaqlrpsvdisvtadadfvrpelrqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qmgD (D:)
    mvsapsidtpsattfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvi
    gwgsqapaqaqnlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetis
    gsdlvlllisdsaqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcp
    kgmgpsvrrlyvqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqe
    yksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmla
    lynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpaf
    pmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiin
    esvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapin
    qdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qmgD (D:)
    attfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaq
    nlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisd
    saqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrly
    vqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqeyksdifgergi
    llgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmlalynslseegkk
    dfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpafpmgkidqtrmw
    kvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiinesvieavdsln
    pfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapinqdlisnflsdp
    vheaigvcaqlrpsvdisvtadadfvrpelrqa