PDB entry 1qmd

View 1qmd on RCSB PDB site
Description: calcium bound closed form alpha-toxin from clostridium perfringens
Deposited on 1999-09-27, released 2000-02-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-06, with a file datestamp of 2000-02-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmdA (A:)
    wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
    aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
    lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdil
    knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
    hdvsegndpsvgknvkelvayistsgekdagtddymyfgiktkdgktqewemdnpgndfm
    tgskdtytfklkdenlkiddiqnmwirkrkytafsdaykpenikiiangkvvvdkdinew
    isgnstynik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmdB (B:)
    wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
    aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
    lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdil
    knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
    hdvsegndpsvgknvkelvayistsgekdagtddymyfgiktkdgktqewemdnpgndfm
    tgskdtytfklkdenlkiddiqnmwirkrkytafsdaykpenikiiangkvvvdkdinew
    isgnstynik