PDB entry 1qmc

View 1qmc on RCSB PDB site
Description: c-terminal dna-binding domain of hiv-1 integrase, nmr, 42 structures
Deposited on 1999-09-27, released 1999-12-14
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-14, with a file datestamp of 1999-12-13.
Experiment type: NMR42
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qmca_
  • Chain 'B':
    Domains in SCOP 1.55: d1qmcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmcA (A:)
    miqnfrvyyrdsrnplwkgpakllwkgegavviqdnsdikvvprrkakiird
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmcB (B:)
    miqnfrvyyrdsrnplwkgpakllwkgegavviqdnsdikvvprrkakiird