PDB entry 1qm9

View 1qm9 on RCSB PDB site
Description: nmr, representative structure
Class: ribonucleoprotein
Keywords: polypyrimidine tract binding protein, rnp, RNA, spicing, translation
Deposited on 1999-09-22, released 2000-07-03
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polypyrimidine tract-binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qm9a1, d1qm9a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qm9A (A:)
mgnsvllvsnlnpervtpqslfilfgvygdvqrvkilfnkkenalvqmadgnqaqlamsh
lnghklhgkpiritlskhqnvqlpregqedqgltkdygnsplhrfkkpgsknfqnifpps
atlhlsnippsvseedlkvlfssnggvvkgfkffqkdrkmaliqmgsveeavqalidlhn
hdlgenhhlrvsfsksti