PDB entry 1qm9

View 1qm9 on RCSB PDB site
Description: nmr, representative structure
Class: ribonucleoprotein
Keywords: ribonucleoprotein, polypyrimidine tract binding protein, rnp, RNA, spicing, translation
Deposited on 1999-09-22, released 2000-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polypyrimidine tract-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26599 (1-197)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1qm9a1, d1qm9a2, d1qm9a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qm9A (A:)
mgnsvllvsnlnpervtpqslfilfgvygdvqrvkilfnkkenalvqmadgnqaqlamsh
lnghklhgkpiritlskhqnvqlpregqedqgltkdygnsplhrfkkpgsknfqnifpps
atlhlsnippsvseedlkvlfssnggvvkgfkffqkdrkmaliqmgsveeavqalidlhn
hdlgenhhlrvsfsksti