PDB entry 1qm7

View 1qm7 on RCSB PDB site
Description: X-ray structure of a three-fingered chimeric protein, stability of a structural scaffold
Class: toxin
Keywords: toxin, stability of a structural scaffold
Deposited on 1999-09-21, released 2000-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: -1.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: r-chii
  Species: synthetic construct, synthetic [TaxId:32630]
  Gene: synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1QM7 (0-60)
  Domains in SCOPe 2.08: d1qm7a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qm7A (A:)
  tmcyshtttsrailtncpgetncykksrrhppkmvlgrgcgcptvapgiklnccttdkcn
  y