PDB entry 1qm6

View 1qm6 on RCSB PDB site
Description: r32 form of clostridium perfringens alpha-toxin strain
Deposited on 1999-09-21, released 1999-09-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-10, with a file datestamp of 2000-04-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qm6A (A:)
    wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
    aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
    lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdil
    knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
    hdvsegndpsvgknvkelvayistsgekdagtddymyfgiktkdgktqewemdnpgndfm
    tgskdtytfklkdenlkiddiqnmwirkrkytafsdaykpenikiiangkvvvdkdinew
    isgnstynik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qm6B (B:)
    wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
    aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
    lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdil
    knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
    hdvsegndpsvgknvkelvayistsgekdagtddymyfgiktkdgktqewemdnpgndfm
    tgskdtytfklkdenlkiddiqnmwirkrkytafsdaykpenikiiangkvvvdkdinew
    isgnstynik