PDB entry 1qm4

View 1qm4 on RCSB PDB site
Description: methionine adenosyltransferase complexed with a l-methionine analogue
Deposited on 1999-09-20, released 2000-09-21
The last revision prior to the SCOP 1.59 freeze date was dated 2000-09-21, with a file datestamp of 2000-09-21.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.23
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qm4A (A:)
    gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
    midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspdiaqcvhldrneedvgagdq
    glmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvqyvqdngav
    ipvrvhtivisvqhneditleamrealkeqvikavvpakyldedtiyhlqpsgrfviggp
    qgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglcrrvl
    vqvsyaigvaeplsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiyqkta
    cyghfgrsefpwevpkklvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qm4A (A:)
    gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
    midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspedvgagdqglmfgyatdete
    ecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvqyvqdngavipvrvhtivisv
    qhneditleamrealkeqvikavvpakyldedtiyhlqpsgrfviggpqgdagvtgrkii
    vdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglcrrvlvqvsyaigvaep
    lsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiyqktacyghfgrsefpw
    evpkklvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qm4B (B:)
    gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
    midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspdiaqcvhldrneedvgagdq
    glmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvqyvqdngav
    ipvrvhtivisvqhneditleamrealkeqvikavvpakyldedtiyhlqpsgrfviggp
    qgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglcrrvl
    vqvsyaigvaeplsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiyqkta
    cyghfgrsefpwevpkklvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qm4B (B:)
    gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
    midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspedvgagdqglmfgyatdete
    ecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvqyvqdngavipvrvhtivisv
    qhneditleamrealkeqvikavvpakyldedtiyhlqpsgrfviggpqgdagvtgrkii
    vdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglcrrvlvqvsyaigvaep
    lsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiyqktacyghfgrsefpw
    evpkklvf