PDB entry 1qm1

View 1qm1 on RCSB PDB site
Description: human prion protein fragment 90-230
Class: membrane protein
Keywords: membrane protein, glycoprotein, gpi-anchor, disease mutation
Deposited on 1999-09-20, released 1999-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qm1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qm1A (A:)
    gsgqgggthsqwnkpskpktnmkhmagaaaagavvgglggymlgsamsrpiihfgsdyed
    ryyrenmhrypnqvyyrpmdeysnqnnfvhdcvnitikqhtvttttkgenftetdvkmme
    rvveqmcitqyeresqayyqrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qm1A (A:)
    lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
    kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqr