PDB entry 1qlz

View 1qlz on RCSB PDB site
Description: human prion protein
Class: prion protein
Keywords: prion protein, prion, brain, glycoprotein, gpi-anchor, repeat, polymorphism, disease mutation
Deposited on 1999-09-20, released 1999-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qlza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qlzA (A:)
    gskkrpkpggwntggsrypgqgspggnryppqggggwgqphgggwgqphgggwgqphggg
    wgqphgggwgqgggthsqwnkpskpktnmkhmagaaaagavvgglggymlgsamsrpiih
    fgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvnitikqhtvttttkgenfte
    tdvkmmervveqmcitqyeresqayyqrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlzA (A:)
    lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
    kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqr