PDB entry 1qly

View 1qly on RCSB PDB site
Description: nmr study of the sh3 domain from bruton's tyrosine kinase, 20 structures
Deposited on 1999-09-20, released 1999-12-14
The last revision prior to the SCOP 1.57 freeze date was dated 2000-06-03, with a file datestamp of 2000-06-03.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1qlya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlyA (A:)
    lkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsnyvteae