PDB entry 1qly

View 1qly on RCSB PDB site
Description: nmr study of the sh3 domain from bruton's tyrosine kinase, 20 structures
Class: tyrosine-protein kinase
Keywords: transferase, tyrosine-protein kinase, phosphorylation, sh3 domain
Deposited on 1999-09-20, released 1999-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qlya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlyA (A:)
    lkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsnyvteae