PDB entry 1qlw

View 1qlw on RCSB PDB site
Description: the atomic resolution structure of a novel bacterial esterase
Class: hydrolase(carboxylic esterase)
Keywords: esterase, anisotropic refinement, atomic resolution, alpha/beta hydrolase
Deposited on 1999-09-17, released 2000-02-10
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.143
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Alcaligenes sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qlwa_
  • Chain 'B':
    Compound: esterase
    Species: Alcaligenes sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qlwb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qlwA (A:)
    apppvpktpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqra
    krypitlihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainav
    klgkapasslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsm
    ptpnptvanlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedv
    kpltsipvlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmm
    mqdrnnlqvadlildwigrntakpahgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlwA (A:)
    vpktpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqrakryp
    itlihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainavklgk
    apasslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsmptpn
    ptvanlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedvkplt
    sipvlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmmmqdr
    nnlqvadlildwigrnta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qlwB (B:)
    apppvpktpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqra
    krypitlihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainav
    klgkapasslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsm
    ptpnptvanlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedv
    kpltsipvlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmm
    mqdrnnlqvadlildwigrntakpahgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlwB (B:)
    vpktpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqrakryp
    itlihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainavklgk
    apasslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsmptpn
    ptvanlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedvkplt
    sipvlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmmmqdr
    nnlqvadlildwigrnt