PDB entry 1qlw

View 1qlw on RCSB PDB site
Description: The Atomic Resolution Structure of a Novel Bacterial Esterase
Class: hydrolase(carboxylic esterase)
Keywords: hydrolase(carboxylic esterase), esterase, anisotropic refinement, atomic resolution, alpha/beta hydrolase
Deposited on 1999-09-17, released 2000-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Alcaligenes sp. [TaxId:512]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QLW
    Domains in SCOPe 2.08: d1qlwa_
  • Chain 'B':
    Compound: esterase
    Species: Alcaligenes sp. [TaxId:512]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QLW
    Domains in SCOPe 2.08: d1qlwb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qlwA (A:)
    apppvpktpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqra
    krypitlihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainav
    klgkapasslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsm
    ptpnptvanlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedv
    kpltsipvlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmm
    mqdrnnlqvadlildwigrntakpahgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlwA (A:)
    vpktpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqrakryp
    itlihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainavklgk
    apasslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsmptpn
    ptvanlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedvkplt
    sipvlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmmmqdr
    nnlqvadlildwigrnta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qlwB (B:)
    apppvpktpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqra
    krypitlihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainav
    klgkapasslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsm
    ptpnptvanlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedv
    kpltsipvlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmm
    mqdrnnlqvadlildwigrntakpahgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlwB (B:)
    vpktpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqrakryp
    itlihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainavklgk
    apasslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsmptpn
    ptvanlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedvkplt
    sipvlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmmmqdr
    nnlqvadlildwigrnt