PDB entry 1qlv

View 1qlv on RCSB PDB site
Description: pyrone synthase (pys) from gerbera hybrida
Class: polyketide synthase
Keywords: polyketide synthase, polyketide, pyrone biosynthesis, chalcone
Deposited on 1999-09-16, released 2000-09-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrone synthase
    Species: GERBERA HYBRIDA [TaxId:18101]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48391
      • cloning artifact (258)
      • modified residue (168)
    Domains in SCOPe 2.02: d1qlva1, d1qlva2
  • Chain 'B':
    Compound: pyrone synthase
    Species: GERBERA HYBRIDA [TaxId:18101]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48391
      • cloning artifact (258)
      • modified residue (168)
    Domains in SCOPe 2.02: d1qlvb1, d1qlvb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qlvA (A:)
    mgsyssddvevireagraqglatilaigtatppncvaqadyadyyfrvtksehmvdlkek
    fkricektaikkrylaltedylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaid
    ewglpkskithlifcttagvdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlak
    dlaennkgsrvlivcseitailfhgpnenhldslvaqalfgdgaaalivgsgphlaverp
    ifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalsplgitdw
    nsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevrkrsma
    egksttgegldcgvlfgfgpgmtvetvvlrsvrvtaavangn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlvA (A:)
    aqglatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylal
    tedylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifctt
    agvdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlakdlaennkgsrvlivcse
    itailfhgpnenhldslvaqalfgdgaaalivgsgphlaverpifeivstdqtilpdtek
    amklhlreggltfqlhrdvplmvaknienaaekalsplgitdwnsvfwmvhpggraildq
    verklnlkedklrasrhvlseygnlisacvlfiidevrkrsmaegksttgegldcgvlfg
    fgpgmtvetvvlrsvrvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qlvB (B:)
    mgsyssddvevireagraqglatilaigtatppncvaqadyadyyfrvtksehmvdlkek
    fkricektaikkrylaltedylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaid
    ewglpkskithlifcttagvdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlak
    dlaennkgsrvlivcseitailfhgpnenhldslvaqalfgdgaaalivgsgphlaverp
    ifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalsplgitdw
    nsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevrkrsma
    egksttgegldcgvlfgfgpgmtvetvvlrsvrvtaavangn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlvB (B:)
    aqglatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylal
    tedylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifctt
    agvdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlakdlaennkgsrvlivcse
    itailfhgpnenhldslvaqalfgdgaaalivgsgphlaverpifeivstdqtilpdtek
    amklhlreggltfqlhrdvplmvaknienaaekalsplgitdwnsvfwmvhpggraildq
    verklnlkedklrasrhvlseygnlisacvlfiidevrkrsmaegksttgegldcgvlfg
    fgpgmtvetvvlrsvr