PDB entry 1qlu

View 1qlu on RCSB PDB site
Description: structure of the h422a mutant vanillyl-alcohol oxidase in complex with isoeugenol
Deposited on 1999-09-16, released 1999-09-20
The last revision prior to the SCOP 1.57 freeze date was dated 2000-07-03, with a file datestamp of 2000-07-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qluA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngaalff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qluA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdphhvmdqdyfl
    asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
    levnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpy
    gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
    dglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmalqnvpt
    irhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwet
    ikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngaalffspiak
    vsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrt
    liddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwp
    sqyshvtwkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qluB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngaalff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qluB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdphhvmdqdyfl
    asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
    levnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpy
    gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
    dglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmalqnvpt
    irhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwet
    ikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngaalffspiak
    vsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrt
    liddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwp
    sqyshvtwkl