PDB entry 1qls

View 1qls on RCSB PDB site
Description: s100c (s100a11),or calgizzarin, in complex with annexin I n-terminus
Class: metal-binding protein/inhibitor
Keywords: metal-binding protein/inhibitor, s100 family, ef-hand protein, complex (ligand/annexin), ligand of annexin II, calcium/phospholipid binding protein
Deposited on 1999-09-15, released 2000-02-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s100c protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1qlsa_
  • Chain 'D':
    Compound: annexin I
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04083 (0-10)
      • engineered (4)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qlsA (A:)
    makrpteterciesliaifqkhagrdgnntkiskteflifmntelaaftqnqkdpgvldr
    mmkkldldsdgqldfqeflnligglaiachdsfikstqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlsA (A:)
    pteterciesliaifqkhagrdgnntkiskteflifmntelaaftqnqkdpgvldrmmkk
    ldldsdgqldfqeflnligglaiachdsfikstqk
    

  • Chain 'D':
    No sequence available.