PDB entry 1qls

View 1qls on RCSB PDB site
Description: s100c (s100a11),or calgizzarin, in complex with annexin i n-terminus
Deposited on 1999-09-15, released 2000-02-25
The last revision prior to the SCOP 1.63 freeze date was dated 2000-02-25, with a file datestamp of 2000-02-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1qlsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qlsA (A:)
  pteterciesliaifqkhagrdgnntkiskteflifmntelaaftqnqkdpgvldrmmkk
  ldldsdgqldfqeflnligglaiachdsfikstqk