PDB entry 1qlr

View 1qlr on RCSB PDB site
Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin
Class: immunoglobulin
Keywords: immunoglobulin, autoantibody, cold agglutinin, human igm fab fragment
Deposited on 1999-09-11, released 2000-09-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.216
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igm kappa chain v-III (kau cold agglutinin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR A23746 (0-214)
      • conflict (22)
      • conflict (88)
      • conflict (134)
      • conflict (194)
      • conflict (214)
    Domains in SCOPe 2.05: d1qlra1, d1qlra2
  • Chain 'B':
    Compound: igm fab region IV-j(h4)-c (kau cold agglutinin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR B23746 (1-End)
      • conflict (21)
    Domains in SCOPe 2.05: d1qlrb1, d1qlrb2
  • Chain 'C':
    Compound: igm kappa chain v-III (kau cold agglutinin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR A23746 (0-214)
      • conflict (22)
      • conflict (88)
      • conflict (134)
      • conflict (194)
      • conflict (214)
    Domains in SCOPe 2.05: d1qlrc1, d1qlrc2
  • Chain 'D':
    Compound: igm fab region IV-j(h4)-c (kau cold agglutinin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR B23746 (1-End)
      • conflict (21)
    Domains in SCOPe 2.05: d1qlrd1, d1qlrd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlrA (A:)
    eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qlrB (B:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpviaelppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlrB (B:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
    qvllptdehvvckvqhpngnkeknvplpv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlrC (C:)
    eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qlrD (D:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpviaelppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlrD (D:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
    qvllptdehvvckvqhpngnkeknvplpv