PDB entry 1qlq

View 1qlq on RCSB PDB site
Description: bovine pancreatic trypsin inhibitor (bpti) mutant with altered binding loop sequence
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1999-09-10, released 1999-10-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.1103
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered mutation (10)
      • engineered mutation (12)
      • engineered mutation (14)
      • engineered mutation (51)
    Domains in SCOPe 2.04: d1qlqa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlqA (A:)
    rpdfcleppyagacrariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga