PDB entry 1qlk

View 1qlk on RCSB PDB site
Description: solution structure of ca(2+)-loaded rat s100b (betabeta) nmr, 20 structures
Class: calcium-binding
Keywords: s100beta, s100b, nmr, ef-hand, s100 protein, calcium-binding protein, four-helix bundle
Deposited on 1997-09-26, released 1998-11-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-100 protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1qlka_
  • Chain 'B':
    Compound: s-100 protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1qlkb_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlkA (A:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldedgdgecdfqefmafvsmvttacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlkB (B:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldedgdgecdfqefmafvsmvttacheffehe