PDB entry 1qlk
View 1qlk on RCSB PDB site
Description: solution structure of ca(2+)-loaded rat s100b (betabeta) nmr, 20 structures
Class: calcium-binding
Keywords: s100beta, s100b, nmr, ef-hand, s100 protein, calcium-binding protein, four-helix bundle
Deposited on
1997-09-26, released
1998-11-11
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: s-100 protein
Species: Rattus norvegicus [TaxId:10116]
Gene: S100beta
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1qlka_ - Chain 'B':
Compound: s-100 protein
Species: Rattus norvegicus [TaxId:10116]
Gene: S100beta
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1qlkb_ - Heterogens: CA
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1qlkA (A:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1qlkB (B:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe