PDB entry 1qli

View 1qli on RCSB PDB site
Description: quail cysteine and glycine-rich protein, nmr, minimized average structure
Deposited on 1997-02-17, released 1997-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1qli_1, d1qli_2

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qli_ (-)
  aekcsrcgdsvyaaekvigagkpwhkncfrcakcgkslesttltekegeiyckgcyakn