PDB entry 1qlh

View 1qlh on RCSB PDB site
Description: horse liver alcohol dehydrogenase complexed to nad double mutant of gly 293 ala and pro 295 thr
Class: oxidoreductase
Keywords: oxidoreductase, dehydrogenase, alcohol, nicotinamide coenzyme, double mutant
Deposited on 1999-08-31, released 2000-01-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered mutation (292)
      • engineered mutation (294)
    Domains in SCOPe 2.06: d1qlha1, d1qlha2
  • Heterogens: ZN, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlhA (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivavtpdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf