PDB entry 1qld

View 1qld on RCSB PDB site
Description: solution structure of type x cbm
Class: xylanase
Keywords: xylanase, beta strands, anti parallel beta sheets, xylan degradation, hydrolase, glycosidase
Deposited on 1999-08-26, released 2000-02-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14768 (1-49)
      • cloning artifact (0)
    Domains in SCOPe 2.04: d1qlda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qldA (A:)
    mgnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg