PDB entry 1qld

View 1qld on RCSB PDB site
Description: solution structure of type x cbm
Deposited on 1999-08-26, released 2000-02-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-14, with a file datestamp of 2000-09-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qlda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qldA (A:)
    mgnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg