PDB entry 1ql6

View 1ql6 on RCSB PDB site
Description: the catalytic mechanism of phosphorylase kinase probed by mutational studies
Class: kinase (glycogen metabolism)
Keywords: kinase (glycogen metabolism), glycogen metabolism, transferase, serine/threonine-protein, kinase, ATP-binding, calmodulin-binding
Deposited on 1999-08-24, released 1999-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.24
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphorylase kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00518
      • engineered (181)
    Domains in SCOPe 2.06: d1ql6a_
  • Heterogens: ATP, MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ql6A (A:)
    trdaalpgshsthgfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsa
    eevqelreatlkevdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvt
    lseketrkimrallevicalhklnivhrdlkpenilldddmnikltdfgfscqldpgekl
    rsvcgtpsylapeiiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrm
    imsgnyqfgspewddysdtvkdlvsrflvvqpqkrytaeealahpffqqyvveevrhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ql6A (A:)
    sthgfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreat
    lkevdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkim
    rallevicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrsvcgtpsyl
    apeiiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgs
    pewddysdtvkdlvsrflvvqpqkrytaeealahpffqqyv