PDB entry 1ql6

View 1ql6 on RCSB PDB site
Description: the catalytic mechanism of phosphorylase kinase probed by mutational studies
Deposited on 1999-08-24, released 1999-12-14
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-14, with a file datestamp of 1999-12-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.24
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ql6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ql6A (A:)
    sthgfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreat
    lkevdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkim
    rallevicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrsvcgtpsyl
    apeiiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgs
    pewddysdtvkdlvsrflvvqpqkrytaeealahpffqqyv