PDB entry 1qkz

View 1qkz on RCSB PDB site
Description: fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain II from streptococcal protein g
Class: immune system
Keywords: immune system, fab, pora, neisseria meningitidis, porin
Deposited on 1999-08-17, released 2000-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g-prime
    Species: STREPTOCOCCUS SP. [TaxId:1320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54181
      • engineered (23)
    Domains in SCOPe 2.07: d1qkza_
  • Chain 'H':
    Compound: antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL MMU245477 (0-124)
    Domains in SCOPe 2.07: d1qkzh1, d1qkzh2
  • Chain 'L':
    Compound: antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL MMU245476 (0-115)
    • PDB 1QKZ (123-216)
    Domains in SCOPe 2.07: d1qkzl1, d1qkzl2
  • Chain 'P':
    Compound: major outer membrane protein p1.16
    Species: NEISSERIA MENINGITIDIS, synthetic [TaxId:487]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qkzA (A:)
    mtpavttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvt
    ekpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkzA (A:)
    vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtek
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkzH (H:)
    dvklvesggglvkpgrslklscaasgftfsdyymfwvrqtpeqrlewvatisdggaytyy
    pdsvkgrftisrdnaknnlylqmnslksedtgmyycardpleyygmdywgqgtsvavssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvnvtsstwpsqsitcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1qkzL (L:)
    nivmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliytvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthfptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkzL (L:)
    nivmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliytvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthfptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'P':
    No sequence available.