PDB entry 1qku

View 1qku on RCSB PDB site
Description: wild type estrogen nuclear receptor ligand binding domain complexed with estradiol
Deposited on 1999-08-05, released 2000-08-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-18, with a file datestamp of 2000-08-18.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.216
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qkua_
  • Chain 'B':
    Domains in SCOP 1.55: d1qkub_
  • Chain 'C':
    Domains in SCOP 1.55: d1qkuc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkuA (A:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkuB (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
    ldahrlh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkuC (C:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
    ldahrlh