PDB entry 1qkt

View 1qkt on RCSB PDB site
Description: mutant estrogen nuclear receptor ligand binding domain complexed with estradiol
Deposited on 1999-08-05, released 2000-08-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-18, with a file datestamp of 2000-08-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qkta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qktA (A:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllem
    ldahrlha