PDB entry 1qkt

View 1qkt on RCSB PDB site
Description: mutant estrogen nuclear receptor ligand binding domain complexed with estradiol
Class: nuclear receptor
Keywords: nuclear receptor, agonism, antagonism, steroid, structural proteomics in europe, spine, structural genomics
Deposited on 1999-08-05, released 2000-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: estradiol receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-247)
      • engineered mutation (77)
      • engineered mutation (113)
      • engineered mutation (226)
    Domains in SCOPe 2.07: d1qkta_
  • Heterogens: EST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qktA (A:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllem
    ldahrlha