PDB entry 1qks

View 1qks on RCSB PDB site
Description: cytochrome cd1 nitrite reductase, oxidised form
Class: oxidoreductase
Keywords: enzyme, nitrite reductase, oxidoreductase, denitrification, electron transport, periplasmic
Deposited on 1999-08-05, released 1999-08-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.185
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome cd1 nitrite reductase
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72181 (Start-566)
      • conflict (159)
      • conflict (184)
      • conflict (190)
      • conflict (330)
    Domains in SCOP 1.73: d1qksa1, d1qksa2
  • Chain 'B':
    Compound: cytochrome cd1 nitrite reductase
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72181 (Start-566)
      • conflict (159)
      • conflict (184)
      • conflict (190)
      • conflict (330)
    Domains in SCOP 1.73: d1qksb1, d1qksb2
  • Heterogens: SO4, HEC, DHE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qksA (A:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqia
    lidgstyeiktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qksA (A:)
    dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc
    hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll
    ldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstye
    iktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
    kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
    rpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvv
    idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
    wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
    tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
    rlvtptgkfnvyntmtdty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qksB (B:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqia
    lidgstyeiktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qksB (B:)
    dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc
    hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll
    ldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstye
    iktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
    kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
    rpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvv
    idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
    wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
    tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
    rlvtptgkfnvyntmtdty