PDB entry 1qkq

View 1qkq on RCSB PDB site
Description: charcot-leyden crystal protein - mannose complex
Deposited on 1999-07-31, released 2000-01-18
The last revision prior to the SCOP 1.61 freeze date was dated 2000-01-18, with a file datestamp of 2000-01-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.236
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1qkqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qkqA (A:)
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr