PDB entry 1qkq

View 1qkq on RCSB PDB site
Description: charcot-leyden crystal protein - mannose complex
Class: hydrolase
Keywords: serine esterase, hydrolase
Deposited on 1999-07-31, released 2000-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eosinophil lysophospholipase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qkqa_
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qkqA (A:)
    msllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgr
    rvvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpea
    vkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkqA (A:)
    sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsylkr