PDB entry 1qko

View 1qko on RCSB PDB site
Description: high resolution x-ray structure of an early intermediate in the bacteriorhodopsin photocycle
Deposited on 1999-07-30, released 1999-10-24
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-04, with a file datestamp of 1999-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2607
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qkoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkoA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge