PDB entry 1qkn

View 1qkn on RCSB PDB site
Description: rat oestrogen receptor beta ligand-binding domain in complex with antagonist raloxifene
Class: nuclear receptor
Keywords: nuclear receptor, transcription factor, antagonist
Deposited on 1999-07-27, released 2000-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: OESTROGEN RECEPTOR BETA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qkna_
  • Heterogens: ACT, RAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qknA (A:)
    vkelllstlspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwak
    kipgfvelslldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegil
    eifdmllattsrfrelklqhkeylcvkamillnssmyplasanqeaessrklthllnavt
    dalvwviaksgissqqqsvrlanllmllshvrhisnkgmehllsmkcknvvpvydlllem
    lnahltrgykssisg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qknA (A:)
    tlspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwakkipgfve
    lslldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmll
    attsrfrelklqhkeylcvkamillnssmyplasanqeaessrklthllnavtdalvwvi
    aksgissqqqsvrlanllmllshvrhisnkgmehllsmkdlllemlna