PDB entry 1qkm

View 1qkm on RCSB PDB site
Description: human oestrogen receptor beta ligand-binding domain in complex with partial agonist genistein
Class: nuclear receptor
Keywords: nuclear receptor, transcription factor, phyto-oestrogen, partial agonist
Deposited on 1999-07-27, released 2000-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.215
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: OESTROGEN RECEPTOR BETA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qkma_
  • Heterogens: GEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qkmA (A:)
    vrellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswak
    kipgfvelslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegil
    eifdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavt
    dalvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllem
    lnahvlrgckssitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkmA (A:)
    ldalspeqlvltlleaepphvlisrpasmmmsltkladkelvhmiswakkipgfvelslf
    dqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllatts
    rfrelklqhkeylcvkamillnssmyplvadssrklahllnavtdalvwviaksgissqq
    qsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl